PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G031000.1
Common NamePHAVU_002G031000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family ZF-HD
Protein Properties Length: 354aa    MW: 39329.6 Da    PI: 7.5258
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G031000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.33.6e-33136191359
         ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                         ++rY+eCl+NhAas+G+h+vDGCgEfm+s geegt+++l+CaAC+CHRnFHR+eve 
  Phvul.002G031000.1 136 SIRYRECLRNHAASMGSHVVDGCGEFMAS-GEEGTPESLRCAACECHRNFHRKEVEG 191
                         689*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-20135190IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.7E-30137189IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.3E-30138189IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.346139188IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466897.17E-17286349IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.0E-27287350IPR009057Homeodomain-like
TIGRFAMsTIGR015653.5E-25293350IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MEMEGQDKEI EIPTSLGYNL PNRDSSSSSS KLSSPTVGER STTHHDHGHD HGDHDHGHDQ  60
LHQPPHQTHT LIFNEPPHHN LYQPPPPLAP RQPHRLTPDP DLSTPIAPTS NPLRTAHPQT  120
TTIAAAAATT TTSTPSIRYR ECLRNHAASM GSHVVDGCGE FMASGEEGTP ESLRCAACEC  180
HRNFHRKEVE GELQPQQPPP LSLLPQQQQQ QHAPNYHSYY PNNHNGHLHY PTPSPSSLHH  240
RLVGSSGTPS LVPPVMMAFG GPAESSSEDL NMFQSNTGGA HAQLSVQAPV SSKKRFRTKF  300
SKQQKDRMME FAEKIGWKIQ KHNEQEVQHF CSQAGVKRQV FKVWMHNNKK HPM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A7e-222923491673ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007156949.10.0hypothetical protein PHAVU_002G031000g
TrEMBLV7CHV60.0V7CHV6_PHAVU; Uncharacterized protein
STRINGGLYMA11G07360.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.12e-49homeobox protein 33